PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000434.1.g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family FAR1
Protein Properties Length: 145aa    MW: 16145 Da    PI: 6.2774
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000434.1.g00005.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1552.7e-1771142173
                            FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekd 73 
                                     kfY eYA++vGFsvr+ + ++   +g++  r++ C+k+g++ ++k k  +e+r+r++ r gC+a++ vk++k+
  FANhyb_rscf00000434.1.g00005.1  71 KFYTEYARRVGFSVRVMQRRRG-IDGTTLARRLGCNKQGFSPNHKGKLGHEQRPRVSAREGCNATILVKMDKS 142
                                     6****************98887.9999********************9*********************9874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031019.7E-1571142IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MSSSSFFKEL LFTHKRTTIT TTTMDLEDEE DEEEVGAVGG SAEVNMDGSE GGPVGEPYVG  60
MEFDSEEDAK KFYTEYARRV GFSVRVMQRR RGIDGTTLAR RLGCNKQGFS PNHKGKLGHE  120
QRPRVSAREG CNATILVKMD KSAQR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004290122.11e-72PREDICTED: protein FAR1-RELATED SEQUENCE 1
TrEMBLW9QZE12e-50W9QZE1_9R
STRINGGLYMA18G24443.12e-44(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96531104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12850.24e-35FAR1 family protein